DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and ypt4

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:95/207 - (45%)
Similarity:133/207 - (64%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEV----DDKKIKLQIWDT 91
            :|:|:.|.::.|..|.||||||.:|.:.::.....||:|::|.:|||.|    ..|:||||||||
pombe     5 SYDYLVKIVLAGPSGTGKSCLLQRFVKNQWDDQVSHTVGIDFASRIISVGMGNQQKRIKLQIWDT 69

  Fly    92 AGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTV-IFLIGNKSDLEST 155
            ||||:||:|.|:||||||||::|||:|.:.::..|||||:|.|.:. |||: :.|.|:||||::.
pombe    70 AGQEKFRSVARNYYRGAAGAVLVYDVTNKDSFEELSSWLSDIRAMA-PSTICVVLAGSKSDLQNQ 133

  Fly   156 REVTYEEAKEFADENGLMFL-EASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQH--- 216
            |:|:.|||.||..|..:... |.|:.||.||||.||.....|...|:.|.:|......|:|:   
pombe   134 RQVSTEEAAEFCSEKHISSAHETSSYTGSNVEECFLSVVSTIITRIELGEIDPQDQSLGIQYGDL 198

  Fly   217 ---RPSQPSRTS 225
               ||..||.||
pombe   199 SFRRPVHPSSTS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 83/170 (49%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 82/168 (49%)
Rab 10..173 CDD:206640 81/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I957
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - otm47404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.