DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RAB12

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001020471.3 Gene:RAB12 / 201475 HGNCID:31332 Length:340 Species:Homo sapiens


Alignment Length:196 Identity:77/196 - (39%)
Similarity:118/196 - (60%) Gaps:3/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAG 93
            |...::..:.||||..||||:.|:.:||:..|...|..|:||:|..:.:|:..|||:||||||||
Human   132 PRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAG 196

  Fly    94 QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREV 158
            ||||.::|.:|||.|.|.::|||||::.|::.|..|:.......:....:.|:|||.|.|:.||:
Human   197 QERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREI 261

  Fly   159 TYEEAKEFADE-NGLMFLEASAMTGQNVEEAFLETARKIYQNIQEG--RLDLNASESGVQHRPSQ 220
            |.::.::||.: .|:.|.||||....||:|.||:....|.:.:...  |.:|:.|...:|..|..
Human   262 TRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEI 326

  Fly   221 P 221
            |
Human   327 P 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 70/165 (42%)
RAB12NP_001020471.3 Rab12 139..340 CDD:206699 76/189 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.