Sequence 1: | NP_788056.1 | Gene: | Rab14 / 34840 | FlyBaseID: | FBgn0015791 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020471.3 | Gene: | RAB12 / 201475 | HGNCID: | 31332 | Length: | 340 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 77/196 - (39%) |
---|---|---|---|
Similarity: | 118/196 - (60%) | Gaps: | 3/196 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAG 93
Fly 94 QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREV 158
Fly 159 TYEEAKEFADE-NGLMFLEASAMTGQNVEEAFLETARKIYQNIQEG--RLDLNASESGVQHRPSQ 220
Fly 221 P 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab14 | NP_788056.1 | Rab14 | 34..199 | CDD:133322 | 70/165 (42%) |
RAB12 | NP_001020471.3 | Rab12 | 139..340 | CDD:206699 | 76/189 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |