DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab5b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_803130.1 Gene:Rab5b / 19344 MGIID:105938 Length:215 Species:Mus musculus


Alignment Length:194 Identity:77/194 - (39%)
Similarity:118/194 - (60%) Gaps:1/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAV 100
            ||.:::|:..||||.|:.:|.:.:|......|||..|.|:.:.:||..:|.:|||||||||:.::
Mouse    21 FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSL 85

  Fly   101 TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 165
            ...|||||..|::|||||.:.|:....:|:.:.:...:||.||.|.|||:||.:.|.|.||||:.
Mouse    86 APMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQA 150

  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQ-HRPSQPSRTSLSS 228
            :||:|.|:|:|.||.|..||.:.||..|:|:.::..:..........||. |..||.:::...|
Mouse   151 YADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 71/162 (44%)
Rab5bNP_803130.1 Rab5_related 20..182 CDD:206653 71/160 (44%)
Effector region. /evidence=ECO:0000255 49..57 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..215 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.