DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab4b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_083667.1 Gene:Rab4b / 19342 MGIID:105071 Length:213 Species:Mus musculus


Alignment Length:214 Identity:123/214 - (57%)
Similarity:151/214 - (70%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
            |:::||:::||..|.|||||||||.|.||..:..||||||||:|::.|..|.:||||||||||||
Mouse     5 YDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQER 69

  Fly    97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
            ||:|||||||||||||:|||||.|.|||.|::||||.|.|.:|:.|:.|.|||.||:..||||:.
Mouse    70 FRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFL 134

  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQH------RPSQ 220
            ||..||.||.|||||.||:||:|||||||:.||.|...|..|.||.....||:|:      :..|
Mouse   135 EASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDISLRQLRQ 199

  Fly   221 PSRTSLSSEATGAKDQCSC 239
            |.    |::|. |...|.|
Mouse   200 PR----SAQAV-APQPCGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 108/164 (66%)
Rab4bNP_083667.1 Rab4 9..169 CDD:206696 107/159 (67%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.