DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab4a

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_033029.2 Gene:Rab4a / 19341 MGIID:105069 Length:218 Species:Mus musculus


Alignment Length:220 Identity:125/220 - (56%)
Similarity:155/220 - (70%) Gaps:11/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWD 90
            ||....|:::||:::||:.|.|||||||||.||||..:..||||||||::||.|..|.:||||||
Mouse     4 TAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWD 68

  Fly    91 TAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLEST 155
            ||||||||:|||||||||||||:|||||.|.|||.|::||||.|.|.:.:.|:.|.|||.||::.
Mouse    69 TAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDAD 133

  Fly   156 REVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPS- 219
            ||||:.||..||.||.|||||.||:||:||||||::.||||...|:.|.||.....||:|:..: 
Mouse   134 REVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAA 198

  Fly   220 -----QPSRTSLSSEATGAKDQCSC 239
                 .|.||...|     ..:|.|
Mouse   199 LRQLRSPRRTQAPS-----AQECGC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 109/164 (66%)
Rab4aNP_033029.2 Rab4 14..174 CDD:206696 107/159 (67%)
Effector region. /evidence=ECO:0000250 42..50 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.