DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab-6.1

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_498993.1 Gene:rab-6.1 / 176275 WormBaseID:WBGene00004269 Length:205 Species:Caenorhabditis elegans


Alignment Length:209 Identity:70/209 - (33%)
Similarity:119/209 - (56%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAV 100
            ||.:.:|:..|||:.::.:|....|......|||::|.::.:.::|:.|:||:||||||||||::
 Worm    12 FKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSL 76

  Fly   101 TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 165
            ..||.|.::.|::|||||..::::..:.|:.|.||......:|.|:|||:||...|:|:.|:.::
 Worm    77 IPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKRQVSTEDGEK 141

  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL---- 226
            .|.:..:||:|.||..|.||::.|.:.|..:...:||             ..|.||:...:    
 Worm   142 KARDLNVMFIETSAKAGYNVKQLFRKIATALPGIVQE-------------ETPEQPNIVIMNPPK 193

  Fly   227 -SSEATGAKDQCSC 239
             :.|:.|.  ||.|
 Worm   194 DAEESQGR--QCPC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 60/162 (37%)
rab-6.1NP_498993.1 Rab6 12..172 CDD:206654 60/159 (38%)
RAB 12..170 CDD:197555 59/157 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.