DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab-5

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_492481.1 Gene:rab-5 / 172755 WormBaseID:WBGene00004268 Length:208 Species:Caenorhabditis elegans


Alignment Length:207 Identity:76/207 - (36%)
Similarity:119/207 - (57%) Gaps:19/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQ 87
            ||.|..       ||.:::|:..||||.|:.:|.:.:|......|||..|.|:.:.:||..||.:
 Worm    14 PNRTCQ-------FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFE 71

  Fly    88 IWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDL 152
            |||||||||:.::...|||||..|::|||||.:.::....:|:.:.:...:|:.|:.|.|||:|:
 Worm    72 IWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADV 136

  Fly   153 ESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKI----YQNIQEGRLDLNASESG 213
            .:.|.|.||||..:|::|.|:|:|.||.|..||.:.|:..|:|:    .|....|.:|:|     
 Worm   137 ANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKLPIGPAQGEPTGTVDMN----- 196

  Fly   214 VQHRPSQPSRTS 225
               :|.|..:.|
 Worm   197 ---QPQQQQKGS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 66/168 (39%)
rab-5NP_492481.1 Rab5_related 19..181 CDD:206653 66/168 (39%)
Ras 21..181 CDD:278499 65/159 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.