DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and unc-108

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001343725.1 Gene:unc-108 / 171956 WormBaseID:WBGene00006833 Length:223 Species:Caenorhabditis elegans


Alignment Length:216 Identity:131/216 - (60%)
Similarity:161/216 - (74%) Gaps:10/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MTAAP----YNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIK 85
            |:|.|    .:|.|:||||||||.||||||||.|||:|:|......|||||||.|::.:|.|:||
 Worm     1 MSAPPLYGRMSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIK 65

  Fly    86 LQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKS 150
            ||||||||||.||::||||||||||||:|||||||.|:|||:|||.|.|..:|.:.||.||||||
 Worm    66 LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKS 130

  Fly   151 DLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGV- 214
            |||:.|||..||.:.||.|:||:|:|.||.|..||||||::||::||:.||||..|:|...:|: 
 Worm   131 DLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIK 195

  Fly   215 ---QHRPSQPSRTSLSSEATG 232
               ||.||.|:  |....|||
 Worm   196 LGPQHSPSSPN--SPGGNATG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 111/164 (68%)
unc-108NP_001343725.1 Ras 10..202 CDD:331851 121/191 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.