DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and AgaP_AGAP002092

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_320947.5 Gene:AgaP_AGAP002092 / 1281369 VectorBaseID:AGAP002092 Length:237 Species:Anopheles gambiae


Alignment Length:215 Identity:84/215 - (39%)
Similarity:130/215 - (60%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95
            :|.::||.:::|:.||||:||:.:||:..|......||||:|..:.:|||::|||||||||||||
Mosquito     3 DYKFLFKVVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVDNQKIKLQIWDTAGQE 67

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160
            |||::|:||||.|:..::||||:.:.|::.|..||.:.:...|...:..|:|||:|.:. ||:..
Mosquito    68 RFRSITQSYYRSASALILVYDISCQPTFDCLPDWLREIQEHANSKVLKILVGNKTDRDD-REIPQ 131

  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDL--------NASESGVQHR 217
            |...|||.::|:.|||.||....|||..|.:.|..:.:..:.....|        |.|:..:.| 
Mosquito   132 EVGAEFAKQHGMYFLETSAKQADNVERLFYDIAAVLIEQARTKEFTLRSETSVLTNLSQKTIYH- 195

  Fly   218 PS-------QPSRTSLSSEA 230
            ||       ..:|:|.:|:|
Mosquito   196 PSCCSIGDRNHARSSSTSDA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 73/164 (45%)
AgaP_AGAP002092XP_320947.5 P-loop_NTPase 1..168 CDD:304359 74/165 (45%)
RAB 8..170 CDD:197555 73/162 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.