DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and AgaP_AGAP007901

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_317585.4 Gene:AgaP_AGAP007901 / 1278055 VectorBaseID:AGAP007901 Length:228 Species:Anopheles gambiae


Alignment Length:228 Identity:83/228 - (36%)
Similarity:123/228 - (53%) Gaps:30/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQ 87
            ||  .|..|....||.:::|:..||||.|:.:|.:.:|......|||..|.|:.:.:||..:|.:
Mosquito    19 PN--GATQNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFE 81

  Fly    88 IWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDL 152
            |||||||||:.::...|||||..|::||||....::....:|:.:.:...:|:.||.|.|||:||
Mosquito    82 IWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNSDSFARAKTWVKELQRQASPNIVIALAGNKADL 146

  Fly   153 ESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHR 217
            .::|.|.|||||::||:|||:|:|.||.|..||.:.||....             .||....:|.
Mosquito   147 ANSRVVDYEEAKQYADDNGLLFMETSAKTAVNVNDIFLAIGE-------------CASHCVAEHL 198

  Fly   218 PSQPSRTSLSSEATGA------------KDQCS 238
            ||:   .:|:.|.|..            :.|||
Mosquito   199 PSE---WNLAHENTTVAARNPENEHEMYEKQCS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 68/164 (41%)
AgaP_AGAP007901XP_317585.4 Rab5_related 29..188 CDD:206653 68/158 (43%)
Ras 31..188 CDD:278499 67/156 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.