DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab18

DIOPT Version :10

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_309827.5 Gene:Rab18 / 1271081 VectorBaseID:AGAMI1_001194 Length:203 Species:Anopheles gambiae


Alignment Length:78 Identity:22/78 - (28%)
Similarity:30/78 - (38%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 WEGDVLTL------SRVSRYDMGA-YLCIATNGVPPSVSKRIKVS--VDFPPMLWIPHQLVGIPV 331
            |....||.      |.:|....|| .|.|...|:|....|...||  :||.|.:|.....:.:  
Mosquito   211 WTSAFLTFQHAIESSFLSSVQSGAPDLPITLRGLPEPRYKTSSVSAFIDFFPFIWAFVTFINV-- 273

  Fly   332 GYNVTLECNIEAH 344
             .::|.|...|.|
Mosquito   274 -IHITREIAAENH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322
Rab18XP_309827.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.