DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and si:dkey-34d22.5

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_009290784.1 Gene:si:dkey-34d22.5 / 100535545 ZFINID:ZDB-GENE-131121-578 Length:199 Species:Danio rerio


Alignment Length:189 Identity:69/189 - (36%)
Similarity:110/189 - (58%) Gaps:3/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVD-DKKIKLQIWDTAGQERF 97
            |.||.|:||...|||||:|.::|..:|..:...|||:.|...|:||: ..::.|.|:||||.|.|
Zfish     8 YRFKLIMIGGDCVGKSCMLQRYTRGQFPESVNVTIGMSFRNHILEVEPGVRVALDIYDTAGHESF 72

  Fly    98 RAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF-LIGNKSDLESTREVTYE 161
            ..|....:..:||.|:|:|:....:::::....|:......|.:|.| |:|:|.|.|. |:|:.|
Zfish    73 WQVICCCFPQSAGCLLVFDLGDNKSFSYIKHRYTEVCKAVRPYSVRFLLVGHKCDREE-RDVSQE 136

  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQ 220
            |..|||.:...:::||||.||.||.|||....|.|||.:..|.:.|:.|...::::.::
Zfish   137 EVDEFASKVEALYIEASAKTGHNVAEAFELLTRHIYQGLINGEVHLHESWGKIENKTNK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 65/166 (39%)
si:dkey-34d22.5XP_009290784.1 P-loop_NTPase 8..186 CDD:328724 68/178 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.