DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and dnajc27

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001096154.1 Gene:dnajc27 / 100038110 XenbaseID:XB-GENE-490420 Length:1116 Species:Xenopus tropicalis


Alignment Length:316 Identity:64/316 - (20%)
Similarity:100/316 - (31%) Gaps:108/316 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVNKLHERIDYFIEKCPNMTAAPYNYNYIFKYIIIGD---------------------MGVGKSC 50
            ::|:|..|.|....|           |:..:..|:||                     ||:....
 Frog   343 LLNELFARFDKLAAK-----------NHQLRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVD 396

  Fly    51 LLHQFTEKKFMANCPHTIGVEFGTRIIEV-DDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMV 114
            .: .:..:|...:....:||..||.|..| ..|:.:..:|.|       .||.:....|.|....
 Frog   397 AI-SYVREKTKTDVDMRVGVHSGTVIGGVLGQKRWQYDVWST-------DVTLANKMEAGGIPGR 453

  Fly   115 YDITRRSTYNHLSSWL--------TDTRNLTNPSTVIFLI-----------------------GN 148
            ..|: :|||:.|....        |....|.....|.:|:                       ||
 Frog   454 VHIS-QSTYDCLKGEFEVEPGEGGTRCDYLREKGIVTYLVIVPKQPINKNGINGVKLSLTSSHGN 517

  Fly   149 KSDLESTRE---------VTYEEAKE---------FADENGLMFL----EASAMTGQN------- 184
            ...|.:|:|         .|.:|.:|         |.:....:.|    |......||       
 Frog   518 SPQLINTKECNGSIHTTCTTPDENEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQQNEQELNKL 582

  Fly   185 VEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSLSSE-ATGAKDQCSC 239
            :.||.||  |:..| :.:|:.....|...:  .|...:|.|:..| .:||...|||
 Frog   583 LNEALLE--RETVQ-VLKGKYTYRLSMRFI--NPEMETRFSVEKEKQSGAAFSCSC 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 46/246 (19%)
dnajc27NP_001096154.1 AC_N <37..291 CDD:292831
CYCc 273..469 CDD:214485 30/145 (21%)
Guanylate_cyc 310..482 CDD:278633 31/158 (20%)
CYCc 854..1073 CDD:214485
Guanylate_cyc 885..1093 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.