Sequence 1: | NP_788056.1 | Gene: | Rab14 / 34840 | FlyBaseID: | FBgn0015791 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096154.1 | Gene: | dnajc27 / 100038110 | XenbaseID: | XB-GENE-490420 | Length: | 1116 | Species: | Xenopus tropicalis |
Alignment Length: | 316 | Identity: | 64/316 - (20%) |
---|---|---|---|
Similarity: | 100/316 - (31%) | Gaps: | 108/316 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 VVNKLHERIDYFIEKCPNMTAAPYNYNYIFKYIIIGD---------------------MGVGKSC 50
Fly 51 LLHQFTEKKFMANCPHTIGVEFGTRIIEV-DDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMV 114
Fly 115 YDITRRSTYNHLSSWL--------TDTRNLTNPSTVIFLI-----------------------GN 148
Fly 149 KSDLESTRE---------VTYEEAKE---------FADENGLMFL----EASAMTGQN------- 184
Fly 185 VEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSLSSE-ATGAKDQCSC 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab14 | NP_788056.1 | Rab14 | 34..199 | CDD:133322 | 46/246 (19%) |
dnajc27 | NP_001096154.1 | AC_N | <37..291 | CDD:292831 | |
CYCc | 273..469 | CDD:214485 | 30/145 (21%) | ||
Guanylate_cyc | 310..482 | CDD:278633 | 31/158 (20%) | ||
CYCc | 854..1073 | CDD:214485 | |||
Guanylate_cyc | 885..1093 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |