DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and M03A1.8

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001122624.1 Gene:M03A1.8 / 6418630 WormBaseID:WBGene00077490 Length:382 Species:Caenorhabditis elegans


Alignment Length:96 Identity:22/96 - (22%)
Similarity:38/96 - (39%) Gaps:20/96 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PSHVRSDQKLTLTLG-GDEFLGFMIQARDGQNRVVGQFQVVDSVHSQTLDC-----SGKDDTITH 108
            ||.|    .:|:|.. .|.|:....:..:.::.|    ::.:.|:.....|     |...|..|:
 Worm    30 PSRV----NITVTCNKNDGFMSLKWKTEEKRSAV----KIYNGVNLLEFVCGFPIGSSNIDVKTY 86

  Fly   109 -LSAQKGKPLTGITFDWIPPAGYKGNVKFMA 138
             |...|.:.||....|:     |.|:|..|:
 Worm    87 KLETLKSENLTSCEIDF-----YPGDVLLMS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 22/96 (23%)
M03A1.8NP_001122624.1 B561 151..279 CDD:214769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.