DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and si:dkey-251i10.2

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001313480.1 Gene:si:dkey-251i10.2 / 562682 ZFINID:ZDB-GENE-050506-102 Length:193 Species:Danio rerio


Alignment Length:145 Identity:51/145 - (35%)
Similarity:83/145 - (57%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGPS-HVRSDQKLTLTLGGDEFLGFMIQARDG 78
            ||:|..|||.:||.|:.|:||.:.|....||:|...| ..::...:|:.:.|.::.|.:::||.|
Zfish    18 VHSYGTGAPTSACGDMIPRHGVQPQPNPAPYTIQASSTKFQAGIPITVVIKGPDYKGVLLEARSG 82

  Fly    79 QN-RVVGQFQVVDSVHSQTLDCSG-KDDTITHLSAQKGKPLTGITFDWIPPAGYKGNVKFMATVV 141
            .: ..:|.:| :...:::.|:||| |...|||.:|......|  .:.|:|||..| |:.||||||
Zfish    83 SDTTALGSWQ-MPPANTKFLECSGNKQGAITHSNANVKNNST--VYTWVPPATTK-NIMFMATVV 143

  Fly   142 QTGFVYWVGRVTKDI 156
            |...|:||..::..:
Zfish   144 QQRNVFWVNVMSSSL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 42/124 (34%)
si:dkey-251i10.2NP_001313480.1 Reeler 30..151 CDD:280232 42/124 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5128
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1223313at2759
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 1 1.000 - - oto39937
orthoMCL 1 0.900 - - OOG6_108549
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.