DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and frrs1b

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_017209487.1 Gene:frrs1b / 557898 ZFINID:ZDB-GENE-080917-44 Length:609 Species:Danio rerio


Alignment Length:159 Identity:58/159 - (36%)
Similarity:85/159 - (53%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGPSHVRS---DQKLTLT 62
            |:.:|:|....:.:|..||||....||.|:|||||...:.|.||:.|:......|   :.|:||.
Zfish     3 MWIVLLLLLIHSETVLCYSDGNVVVACEDMTPQHGYDPKTTDPPFIITADKSQFSPGDEVKVTLA 67

  Fly    63 LGGDE----FLGFMIQARD--GQNRVVGQFQVVDSVHSQTLDCSGK-DDTITHLSAQKGKPLTGI 120
            :|..|    |.||:|:||:  ..|.:||.|:::.|..||.|.|:.| |..::|.|   ||..|.:
Zfish    68 MGFSEGKKYFKGFLIEARNAGNLNEIVGSFKLISSDLSQLLTCNNKRDSAVSHTS---GKHKTEV 129

  Fly   121 TFDWIPPAGYKGNVKFMATVVQTGFVYWV 149
            ...|:.|.....:|:|:.||.|....|||
Zfish   130 QVIWVAPPDSPSSVQFLVTVAQGMHDYWV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 47/131 (36%)
frrs1bXP_017209487.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574266
Domainoid 1 1.000 79 1.000 Domainoid score I8666
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.