DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and FRRS1

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001013682.2 Gene:FRRS1 / 391059 HGNCID:27622 Length:626 Species:Homo sapiens


Alignment Length:159 Identity:45/159 - (28%)
Similarity:73/159 - (45%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAACLAI----SVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGPSH--------VRSDQKL 59
            |..|:.:    .|..|.:|....:|..:.|:||      ..|.|:  |.|        .|...::
Human     8 LGTCILLLHISYVANYPNGKVTQSCHGMIPEHG------HSPQSV--PVHDIYVSQMTFRPGDQI 64

  Fly    60 TLTLGGDEFLGFMIQARDGQN---RVVGQFQVVDSVHSQTLDCSG-KDDTITHLSAQKGKPLTGI 120
            .:||.|..|.||:::||:.::   ..:|.|.::||..||.|.|.. :...::|.||.|   .|.|
Human    65 EVTLSGHPFKGFLLEARNAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRSASK---KTEI 126

  Fly   121 TFDWIPPAGYKGNVKFMATVVQTGFVYWV 149
            ...|..|:....:.:|:.|||:...:|||
Human   127 KVYWNAPSSAPNHTQFLVTVVEKYKIYWV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 38/133 (29%)
FRRS1NP_001013682.2 Reeler 32..155 CDD:307916 38/133 (29%)
DOMON_SDR_2_like 192..354 CDD:187686
Cyt_b561_FRRS1_like 320..533 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141358
Domainoid 1 1.000 59 1.000 Domainoid score I10765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3670
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.