DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and F23B12.4

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001122926.2 Gene:F23B12.4 / 179944 WormBaseID:WBGene00009081 Length:370 Species:Caenorhabditis elegans


Alignment Length:170 Identity:52/170 - (30%)
Similarity:70/170 - (41%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAACLAISVHAYSDGAP--KAACRDLTP----QHGAKLQVTKPPYSISGPSHVRSDQK---- 58
            ||.|.|.:.:.| |:.||||  .||...:.|    :|...||::.|||.|:      .|||    
 Worm     5 LLFLVALVPVVV-AWPDGAPCVHAAFESMNPLEAVEHQGGLQLSTPPYEIA------VDQKCYWR 62

  Fly    59 ---LTLTLGGDE----FLGFMIQA----RDGQNRVVGQFQVVDSVHSQTLDCSGKDDTITHLSAQ 112
               :.|||.|..    |.||:||.    .|......||...:|...|....|.....:.||...:
 Worm    63 NQPIGLTLQGHNESIWFKGFVIQPFKWNNDQLGERFGQLVRLDDNGSWQQQCFRYQVSATHSHDE 127

  Fly   113 KGKPLTGITFDWIPPAGYKGNVKFMATVVQTGFVYWVGRV 152
            |.|.:.    .|.........|:|:||||:....:||..|
 Worm   128 KKKHIK----MWWKVDDEVDTVQFVATVVKHQTQFWVKSV 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 37/140 (26%)
F23B12.4NP_001122926.2 Reeler 40..169 CDD:260081 39/134 (29%)
ShK 330..367 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1223313at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108549
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.