DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and C13B4.1

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001360457.1 Gene:C13B4.1 / 175104 WormBaseID:WBGene00007545 Length:1025 Species:Caenorhabditis elegans


Alignment Length:157 Identity:30/157 - (19%)
Similarity:56/157 - (35%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ACRDLTPQHGAKLQV---TKPPYSISGPSHVRSDQKLTLTLG--GDEFL---------------- 69
            :|.::....||..||   .:..:.|.||::...::.:.:.||  .||.:                
 Worm   212 SCYNVDGNIGASYQVISDNQIAFEIFGPANTTVNENVYVALGFSDDEKMANISVIECSNLPSETA 276

  Fly    70 ---------GFMIQARDGQNRVVGQF--QVVDSVHSQTLDCSGKDDTITHLSAQKGKPLTGITFD 123
                     ||.....||:..:..:|  |.:..:...::.|.|    :.::..:...|.   .|.
 Worm   277 PTMKFSYNPGFKNARIDGEPPIRAKFIQQSIGRISDGSIYCKG----VVNVGGEAENPQ---IFK 334

  Fly   124 WIPPAGYKGNVKFMATV-VQTGFV-YW 148
            |....||  ::.|.|.. ..||.. :|
 Worm   335 WNKNQGY--HLMFAAGFSADTGLTQHW 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 30/156 (19%)
C13B4.1NP_001360457.1 DoH 65..192 CDD:214768
DOMON_SDR_2_like 193..367 CDD:187686 30/157 (19%)
DoH 398..555 CDD:214768
DoH 605..752 CDD:214768
Cyt_b561_FRRS1_like 718..931 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.