DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and C44B7.5

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_495404.1 Gene:C44B7.5 / 174124 WormBaseID:WBGene00016627 Length:236 Species:Caenorhabditis elegans


Alignment Length:98 Identity:25/98 - (25%)
Similarity:33/98 - (33%) Gaps:32/98 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAA-------CLAISVHAYSDGAPKAACRDLTPQHGAKLQVTKPPYSISGPSHVRSD----- 56
            ||.|||       ||  ..|.|..|.|:...       |.:......  |||..:|...:     
 Worm    18 LLALAASRTHLTDCL--DDHKYCVGLPRGCV-------GTECNFAFS--SISNGTHTEIEIFGNS 71

  Fly    57 --QKLTLTLG-------GDEFLGFMIQARDGQN 80
              .|..|.:|       .|:|:.|.|:...|.|
 Worm    72 VIDKTWLAIGYSADKKMEDDFVVFCIRDDAGTN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 14/68 (21%)
C44B7.5NP_495404.1 DOMON_SDR_2_like 26..200 CDD:187686 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.