DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and LOC1274876

DIOPT Version :10

Sequence 1:NP_609710.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_314065.3 Gene:LOC1274876 / 1274876 VectorBaseID:AGAMI1_014427 Length:231 Species:Anopheles gambiae


Alignment Length:43 Identity:12/43 - (27%)
Similarity:19/43 - (44%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLLVLAACLAISVH-AYSDGAPKAACRDLTPQHGAKLQVTK 42
            |:.||..|..:.:..| |::      ....||.:.|.:|.|.|
Mosquito   162 MYGLLAGAVGIHVLAHVAFN------VLEYLTRRKGGELDVNK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_609710.1 Reeler 27..149 CDD:460411 6/16 (38%)
LOC1274876XP_314065.3 None

Return to query results.
Submit another query.