DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and LOC108179094

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_021327713.1 Gene:LOC108179094 / 108179094 -ID:- Length:546 Species:Danio rerio


Alignment Length:154 Identity:44/154 - (28%)
Similarity:65/154 - (42%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAACLAISVHAYSDGAPKA-ACRDLTPQHG--AKLQVTKP----PYSIS-GPSHVRSDQKLT 60
            ||:....:...:..||||:... .|:.:...||  |..|.:.|    |.::: ..|.|.:...:|
Zfish     9 LLIFGFTMLKFICCYSDGSLLTDQCQSMAIDHGVQASGQDSNPFTVIPDNVTVNSSQVGTGITVT 73

  Fly    61 LTLGGDEFLGFMIQARDGQN-RVVGQFQVVDSVHSQTLDCSGKDDTITHLSAQKGKPLTGITFDW 124
            |:.....|||:|::||:..| ...|.|..:||.:|..| |.  |..:.|   ......|.:...|
Zfish    74 LSTSSVPFLGYMLEARECDNCPPAGTFSGIDSANSLLL-CG--DQAVAH---PNNNDKTSVLVTW 132

  Fly   125 IPPAGYKGNVKFMATVVQTGFVYW 148
            .|.|  .|...|.|..|||....|
Zfish   133 TPQA--TGQFYFRAAFVQTFSFGW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 38/130 (29%)
LOC108179094XP_021327713.1 Reeler 33..151 CDD:307916 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1223313at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.