DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and LOC100491943

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_031756879.1 Gene:LOC100491943 / 100491943 -ID:- Length:594 Species:Xenopus tropicalis


Alignment Length:157 Identity:53/157 - (33%)
Similarity:80/157 - (50%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLLVLAACLAISVHAYSDGAPKAACRDLTPQHGA-KLQVTKPPYSISGPSHVRS-DQKLTLTL 63
            :|.|||. ..|..||..:.:|....||..:.|.|.. ..|.:..||.::..|:..| ..::|:||
 Frog     5 VFGLLVF-WLLINSVQPFGNGNVGLACDTMMPNHRTHAAQESMSPYRVAASSYSFSPGDEITVTL 68

  Fly    64 GGD---EFLGFMIQARD-GQNRVVGQFQVVDSVHSQTLDCSG-KDDTITHLSAQKGKPLTGITFD 123
            ..:   .|.||::|||. ..||:||.|:|::| :||.|||.| ....::|::..|...:|.:   
 Frog    69 LANFNTTFEGFLLQARSVTGNRLVGNFRVLNS-NSQILDCGGVMGLAVSHINTSKKSNITAL--- 129

  Fly   124 WIPPAGYKGNVKFMATVVQTGFVYWVG 150
            |..| ....||.|.||.|:....:|||
 Frog   130 WTAP-DLSDNVHFRATFVRNFKTFWVG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 41/128 (32%)
LOC100491943XP_031756879.1 Reeler 30..154 CDD:396550 41/128 (32%)
DOMON_SDR_2_like 196..360 CDD:187686
Cyt_b561_FRRS1_like 333..541 CDD:176490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.