DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and reeld1

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_031751366.1 Gene:reeld1 / 100485235 -ID:- Length:524 Species:Xenopus tropicalis


Alignment Length:158 Identity:51/158 - (32%)
Similarity:77/158 - (48%) Gaps:25/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLAACLAISVHAYSDGAPKAACRDLTPQH-GAKLQVTKPPYSISGPSHVRSDQKLTLTLGGD- 66
            |...:.||.....|:|.||..:||.|:.|:| .|:.|..|..|..     :|:::  |..|.|| 
 Frog    39 LACASVCLISYSAAFSHGASLSACSDMRPKHIRAQPQNPKKNYIA-----IRTNR--TSYLPGDT 96

  Fly    67 ---------EFLGFMIQARDGQN-RVVGQFQVVDSVHSQTLDCSGKDDTITHLSAQKGKPL-TGI 120
                     :|:||::|||...| :|.|.|..:.. .::.|.|....||:||    ..|.| ..:
 Frog    97 VPVTIRSSRDFMGFLLQARRISNDQVAGSFVFIPP-GAKLLHCFEDGDTVTH----SDKSLKRNL 156

  Fly   121 TFDWIPPAGYKGNVKFMATVVQTGFVYW 148
            :|.|..|....|:::|..:|||:.||||
 Frog   157 SFVWKSPDQPVGDIRFFLSVVQSYFVYW 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 43/135 (32%)
reeld1XP_031751366.1 Reeler 62..184 CDD:396550 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.