DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)34Fc and si:ch73-14h1.2

DIOPT Version :9

Sequence 1:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_003197897.1 Gene:si:ch73-14h1.2 / 100004603 ZFINID:ZDB-GENE-070912-263 Length:326 Species:Danio rerio


Alignment Length:154 Identity:51/154 - (33%)
Similarity:75/154 - (48%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRLLVLAACLAISVHAYSDGAPKAACRDLTPQHGAKLQVTK--PPYSISGPSHVRSD-QKLTLTL 63
            |.|||....|. :|.||..|.....|..:.|.|......|.  .||:::......:| |.:|:||
Zfish    76 FVLLVFVLNLQ-AVTAYPHGRVSGVCSSMVPGHNGTYSSTNLDSPYTVTSDVLYYTDGQVITVTL 139

  Fly    64 GGD--EFLGFMIQARDGQNRVVGQFQVVDSVHSQTLDCSGKDDTITHLSAQKGKPLTGITFDWIP 126
            .|:  ||.||::|||:|. ..||.|.:|.: .||.|:|..:...::|.|:..   .:.:...|..
Zfish   140 QGNNTEFRGFLLQARNGM-EPVGTFTIVGN-SSQLLNCGTEGSAVSHNSSTL---KSTVVAQWNA 199

  Fly   127 PAGYKGNVKFMATVVQTGFVYWVG 150
            |.....:::|.||.||...|||||
Zfish   200 PNINNTDIQFRATFVQNFSVYWVG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 39/126 (31%)
si:ch73-14h1.2XP_003197897.1 Reeler 100..222 CDD:280232 39/126 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E0SP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.