DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTTF and Mterf2

DIOPT Version :9

Sequence 1:NP_609709.1 Gene:mTTF / 34837 FlyBaseID:FBgn0028530 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_030101190.1 Gene:Mterf2 / 74238 MGIID:1921488 Length:402 Species:Mus musculus


Alignment Length:219 Identity:47/219 - (21%)
Similarity:80/219 - (36%) Gaps:50/219 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LLEALRERFRFT--DAELQKI---ISDEL-VHRCYRGRSLTL--------VMDTLQLEGVSRRSF 125
            |:|...|.| ||  :.|.||:   ...|| :......|.||.        |.:..|:.||.:.|:
Mouse   149 LIEQFPESF-FTVKNQENQKLNVQFFQELGLRNVVISRFLTTASSIFHNPVENNKQMIGVLQESY 212

  Fly   126 VEYPWLLSLDNKRLELKMQLLKSMDFKDINHFVPFLRLTVPR----------------------L 168
                  |:|.......|:.|||.:...      ||:.|..||                      |
Mouse   213 ------LNLGGSEANAKVWLLKLLSQN------PFIVLHSPRAVGETLKCLQGQGFTDSEVLQLL 265

  Fly   169 RKLVGALNSERDAMPQRNRVYYISEKLDVSPDIVSKYLSKRLFILEMPFEMFEKNLQHMIDYNVS 233
            .||.|.|...:....| |.:.:.....:.:...:.:.:.|...:|..|..:.|:.:|.::...:|
Mouse   266 SKLKGFLFQLQPGSIQ-NSISFTKTTFECTDYDLRQLVVKCPALLCYPASVLEERIQALLKEGIS 329

  Fly   234 PINVLKDLWAFRYTPKSVQLRLER 257
            ...:.:.......||:.:|.|:.:
Mouse   330 IAQIRESPMVLELTPQIIQYRIRK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTTFNP_609709.1 mTERF <284..378 CDD:327630
Mterf2XP_030101190.1 mTERF 75..377 CDD:388635 47/219 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.