DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTTF and MTERF3

DIOPT Version :9

Sequence 1:NP_609709.1 Gene:mTTF / 34837 FlyBaseID:FBgn0028530 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_057026.3 Gene:MTERF3 / 51001 HGNCID:24258 Length:417 Species:Homo sapiens


Alignment Length:449 Identity:95/449 - (21%)
Similarity:165/449 - (36%) Gaps:124/449 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRSLLRSFETALK--------LHAGLNMHPM----HCSRRLLFSQYENRA--SPSRLTSSGTLGS 52
            :|||:.:.:...:        || |.:..|.    :|..:..|..|...:  :.|:.|||.:..:
Human    17 LRSLINAAQLTKRFTRPARTLLH-GFSAQPQISSDNCFLQWGFKTYRTSSLWNSSQSTSSSSQEN 80

  Fly    53 NEAENDYVPYRQDRETGTK------TRVLLEALRE------RFRFTDAELQKIISD------ELV 99
            |.|::..:|...::...|:      :.:.||.|.|      ....::.|..:||:|      ...
Human    81 NSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFT 145

  Fly   100 HRCYRGRSLTLVMDTLQLEGVSRRSFVEYPWLLSLDNKRLELKMQLLKSMDF-KDINHFVPFLRL 163
            .|.|...|.||  ..|.|.||......::|...:           ||..:|| |||...:.||  
Human   146 LRDYVDHSETL--QKLVLLGVDLSKIEKHPEAAN-----------LLLRLDFEKDIKQMLLFL-- 195

  Fly   164 TVPRLRKLVGALNSERDAMPQRN-------------RVYYISEKLDVSPDIVSKYLSKRLFILEM 215
                  |.||..:::..|...:|             ||.|:..| :.|...|::.:.|..|:|..
Human   196 ------KDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSK-NFSKADVAQMVRKAPFLLNF 253

  Fly   216 PFEMFEKNLQHMIDYNVSPINVLKDLWAFRYTPKSVQLRLERAKRAKKDKIMPWMVRCPEPILQR 280
            ..|..:..|...                        |..||.:.:..:|.:    ||.|. :|..
Human   254 SVERLDNRLGFF------------------------QKELELSVKKTRDLV----VRLPR-LLTG 289

  Fly   281 SLKLSLDELKVLGEFSSVVEYLAHR--LGFSTSEAKAIMDKHPQVHTVRVTKIKEVLDYLLDEAQ 343
            ||:...:.:||            :|  |||..:|.:.::.:.|::.|....|:.|..|::.:...
Human   290 SLEPVKENMKV------------YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMS 342

  Fly   344 FTRFEVAQNPRILCHSLKTTKERMEELKSHGCRPSSLVILCRSRREYDKFLQNWISHER 402
            .....:.:.|::....|...|||            .|.:....|.:||....|:||.::
Human   343 IPHHIIVKFPQVFNTRLFKVKER------------HLFLTYLGRAQYDPAKPNYISLDK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTTFNP_609709.1 mTERF <284..378 CDD:327630 17/95 (18%)
MTERF3NP_057026.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..96 7/26 (27%)
mTERF <159..398 CDD:327630 64/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.