DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTTF and Mterf2

DIOPT Version :9

Sequence 1:NP_609709.1 Gene:mTTF / 34837 FlyBaseID:FBgn0028530 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_038935604.1 Gene:Mterf2 / 366856 RGDID:1311836 Length:394 Species:Rattus norvegicus


Alignment Length:216 Identity:49/216 - (22%)
Similarity:74/216 - (34%) Gaps:76/216 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 NVLKDLWAFRYTPKSVQLRLERAKRA---------KKDKIMPWMVRC-------------PEPIL 278
            |:||:|.|.:....|:   |||...|         .|.|:  |.:.|             ||...
  Rat    91 NILKELGANQTVIASI---LERCPEAIVCSPAAVNTKRKL--WQMVCKTKTELIQLIEQFPESFF 150

  Fly   279 ----QRSLKLSLDELKVLG-------EFSSVVEYLAH------------------RLGFSTSEAK 314
                |.:.||::...:.||       .|.:....:.|                  .||.|.:.||
  Rat   151 AVKDQENQKLNVQFFQELGLKNVVITRFLTTASSIFHNPVENNKQMIGVLLESYLNLGGSEANAK 215

  Fly   315 A----IMDKHPQVHTVRVTKIKEVLDYLLDEAQFTRFEVAQ------------NPRILCHSLKTT 363
            .    ::.::|.:.....|.:.|||.:|..:. ||..||.|            .|..:.:|:..|
  Rat   216 VWLLKLLSQNPFIVLSSPTAVGEVLKFLQGQG-FTDSEVLQLLSKLKGFLFQLQPGSIQNSISFT 279

  Fly   364 KERMEELKSHGCRPSSLVILC 384
            |... |...|..|  .||:.|
  Rat   280 KTTF-ECTDHDLR--QLVVKC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTTFNP_609709.1 mTERF <284..378 CDD:327630 28/134 (21%)
Mterf2XP_038935604.1 mTERF 93..369 CDD:418649 48/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15437
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.