DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss36

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:263 Identity:73/263 - (27%)
Similarity:109/263 - (41%) Gaps:79/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHC------------------V 69
            |..||:||........|||||:.:.|.|:||||:.:...:::||||                  |
Mouse    44 PSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGV 108

  Fly    70 QGQ-----GYQVRA-GSALKNSNGSVVDVAAIRTHEGLGNDIAIVRLSKPLEFTNQVQPIPLAKT 128
            ..|     |..:|: .:.|...|.|.|:         ||.|:|::||:.|.:....|:|:.|.:.
Mouse   109 HSQDGPLEGAHMRSVATILIPDNYSTVE---------LGADLALLRLASPAKLGPSVRPVCLPRA 164

  Fly   129 NP--PPGSIAFVSGWGSSSYYSHPIDLQ-GVNLYIQW---------------------PYYCGLT 169
            :.  ..|:..:.:|||         |:| .|.|.:.|                     |....||
Mouse   165 SHLFAHGTACWATGWG---------DVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLT 220

  Fly   170 ---EPSRICAG--SFGRAACKGDSGGPLVFDQQ----LVGVVSGGTKDC---TYSSIYTSVPYFR 222
               .|..:|||  :..|..|:||||||||.:..    |.|:.|.|. .|   ....::|:|..:.
Mouse   221 FQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGVFTAVAPYE 284

  Fly   223 EWI 225
            .||
Mouse   285 SWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/258 (27%)
Tryp_SPc 27..225 CDD:238113 69/257 (27%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 71/259 (27%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.