DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss59

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:213 Identity:52/213 - (24%)
Similarity:84/213 - (39%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSIQRDGKHLCGGSIYSADIIITAAHCVQGQGYQVRAG---SALKNSNGSVVDVAAIRTHEG 100
            |:.|.:| .....|.|::.....::|||||  ....::|.|   ..:||....:.:.:....|..
Mouse    39 PYMVYLQ-SSPEPCVGTLIDPQWVLTAAHC--SLPTKIRLGVYRPNIKNEKEQICNYSFTVVHPN 100

  Fly   101 -----LGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSY--YSHPIDLQGVNL 158
                 |.||:.:::||.|......|..|.:|..........|:..|..::|  .|.|..|..:|.
Mouse   101 FDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILTWINE 165

  Fly   159 YIQWPYYCGLT-----EPSRI---CAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS 213
            |...|..|..|     :.:||   |.|..  ..:|.|..|..|.:...::.|::|.|.......|
Mouse   166 YSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKASVANGS 230

  Fly   214 --IYTSVPYFREWILNAI 229
              .:|.:..:..|||..|
Mouse   231 KGFFTEIHPYARWILKMI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 48/207 (23%)
Tryp_SPc 27..225 CDD:238113 48/207 (23%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.