DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk12

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:247 Identity:82/247 - (33%)
Similarity:117/247 - (47%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHL-CGGSIYSADIIITAAHC 68
            |.||||....||..    ..|:|..|........||||.:.. ||:| |||.:.....::|||||
Mouse     4 SILLLLCAVGLSQA----DREKIYNGVECVKNSQPWQVGLFH-GKYLRCGGVLVDRKWVLTAAHC 63

  Fly    69 VQGQGYQVRAG----------SALKNSNGSVVDVA---AIRTHEGLGNDIAIVRLSKPLEFTNQV 120
              ...|.||.|          ..|:::..|:...:   |.:.||   :|:.::||::|:..|..|
Mouse    64 --RDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHE---HDLRLLRLNRPIHLTRAV 123

  Fly   121 QPIPLAKTNPPPGSIAFVSGWGSSS--YYSHPIDLQGVNLYIQWPYYCGLTEPSRI-----CA-G 177
            :|:.|..:....|::..|||||:::  :...|..||.:||.......|....|.|:     || |
Mouse   124 RPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTENMLCAGG 188

  Fly   178 SFGRAACKGDSGGPLVFDQQLVGVVS-GGTKDCTYSSI---YTSVPYFREWI 225
            ..|:.||:||||||||....|.|:|| |....|....|   ||.|..:.:||
Mouse   189 EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 72/224 (32%)
Tryp_SPc 27..225 CDD:238113 72/223 (32%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.