DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Klk5

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:232 Identity:69/232 - (29%)
Similarity:119/232 - (51%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGQPIGIEEAPWQ-VSIQRDGKHLCGGSIYSADIIITAAHCVQGQGYQVRAG----SALKNS 85
            ||:.|.....:..||| ..:....|..||..:.|...::||||| :...:::|.|    |.:..|
Mouse    67 RIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHC-RKPVFRIRLGHHSMSPVYES 130

  Fly    86 NGSVVD-VAAI----RTHEGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWG--S 143
            ...:.. :.:|    .:|.|..||:.::::::.:..::.|:|:.:|......|:...|||||  |
Mouse   131 GQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTS 195

  Fly   144 SSYYSHPIDLQGVNLYIQWPYYCGLTEPSRI-----CAG-SFGRAACKGDSGGPLVFDQQLVGVV 202
            ||:.:.|..||.:|:.:.....|..:.|.:|     ||| ..||.:|:||||||:|.:.:|.|:|
Mouse   196 SSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLV 260

  Fly   203 SGGTKDCTYSS---IYTSVPYFREWILNAIDEIMSAN 236
            |.|...|...:   :||::..|.:|    |.:.|::|
Mouse   261 SWGDFPCAQRNRPGVYTNLCEFVKW----IKDTMNSN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 65/219 (30%)
Tryp_SPc 27..225 CDD:238113 64/218 (29%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.