DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and si:dkey-78l4.5

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_003201078.1 Gene:si:dkey-78l4.5 / 567589 ZFINID:ZDB-GENE-060503-930 Length:255 Species:Danio rerio


Alignment Length:273 Identity:75/273 - (27%)
Similarity:121/273 - (44%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLAL--------NSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIY 57
            :.|.|.|||::|        |...|.|..|                |:.||:|.:..|.|||.:.
Zfish     3 IIIISLLLLVSLPPHLTFTVNGNEATPHSR----------------PYMVSVQFNDIHFCGGFLI 51

  Fly    58 SADIIITAAHCVQGQGYQ---VRAGSALKN-SNGSV-VDVAAIRTH-----EGLGNDIAIVRLSK 112
            |.:..:|||||.:....:   |.....||| ..||| :.|.:..||     :.|.|||.:::|.:
Zfish    52 SEEFALTAAHCRKNSAEKLTVVVGAHDLKNKEEGSVRIKVKSCYTHPHFVQKTLQNDIMLLKLER 116

  Fly   113 PLEFTNQVQ--PIPLAKTNPPPGSIAFVSGWGSSSYYSHPI-------------DLQGVNLY--- 159
            .::.:..|.  .:|..|.:...|:|..|.||| ..|.:.|:             ::|.:.|:   
Zfish   117 NVKLSQTVHLTSLPKQKEDTKAGTICSVFGWG-RQYTNGPLSDRLLETEVKIMENMQCLKLWNKR 180

  Fly   160 --IQWPYYCGLTEPSRICAGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKD-CT---YSSIYTSV 218
              |:..|    :....:|....| .:|:||||||||.:..:||:.|.|... |.   :.::||.:
Zfish   181 DDIKVKY----SISKMMCVYGHG-GSCEGDSGGPLVCEDTVVGITSFGNPHLCNSRLFPNVYTKI 240

  Fly   219 PYFREWILNAIDE 231
            ..:.:||...|::
Zfish   241 SAYHDWIWKIINK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 62/232 (27%)
Tryp_SPc 27..225 CDD:238113 62/231 (27%)
si:dkey-78l4.5XP_003201078.1 Tryp_SPc 22..247 CDD:214473 66/246 (27%)
Tryp_SPc 22..247 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.