DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and si:ch211-212d10.1

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_005170576.1 Gene:si:ch211-212d10.1 / 557566 ZFINID:ZDB-GENE-050208-355 Length:252 Species:Danio rerio


Alignment Length:255 Identity:72/255 - (28%)
Similarity:105/255 - (41%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQ-RDGKHLCGGSIYSADIIITAAH 67
            |:..|||.|...:.|..:|  :.|:||:.......|:.|.|: .:.|..|||.:...|.::||||
Zfish     6 QTTSLLLLLRCCAPGFCMR--DGIVGGKVSIPHSRPYMVYIKDSNSKLACGGFLIREDFVLTAAH 68

  Fly    68 C---------------VQGQGYQVRAGSALKNSNGSVVDVAAIRTHEGLGNDIAIVRLSKPLEFT 117
            |               :...|.:|.|....|.:|..             |:||.:::|..|....
Zfish    69 CKRSHLKVYLGVNDTHILPHGIEVEATPHPKFNNAP-------------GDDIMLLKLKTPATLN 120

  Fly   118 NQVQPIPLAK-TNPPPGSIAFVSGWGSSSYYSHPID------LQGVNLYIQWPYYCGLTEPSRIC 175
            ..|..|...: .|........|.|||...|    :|      |:..|:.:.....|| |..:...
Zfish   121 KTVNIITWPECENKEISKDCMVLGWGWQDY----VDGCPSSVLKEANVTLIDFKKCG-TNYTLCT 180

  Fly   176 AGSFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC-TYSSIYTSVPYFREWILNAIDEIMS 234
            .||.|.|  |||||||||......|:||..|:.. .|.:.||.:.::.:|    ||.||:
Zfish   181 NGSIGPA--KGDSGGPLVCGDAAQGIVSFYTESSGVYLTRYTRISHYHQW----IDHIMN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 60/222 (27%)
Tryp_SPc 27..225 CDD:238113 60/221 (27%)
si:ch211-212d10.1XP_005170576.1 Tryp_SPc 27..232 CDD:238113 63/228 (28%)
Tryp_SPc 27..229 CDD:214473 61/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.