DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Cma2

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001019885.1 Gene:Cma2 / 545055 MGIID:88426 Length:246 Species:Mus musculus


Alignment Length:252 Identity:70/252 - (27%)
Similarity:108/252 - (42%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLALNSLS-AGPVIRPEERIIGGQPIGIEEAPWQV---SIQRDG-KHLCGGSIYSADII 62
            :|:.|.|:||...| ||     .|.||||........|:..   :.:|.| ..:|||.:.:...:
Mouse     1 MQALLFLMALLLPSRAG-----AEEIIGGVESEPHSRPYMAYVNTFRRKGYVAICGGFLITPQFV 60

  Fly    63 ITAAHCVQGQGYQVRAGSALKNSNGSVVDVAAIRTHEGL----------GNDIAIVRLSKPLEFT 117
            :||||| .|:...|..|:  .|..........|:..:.:          .|||.:::|.|....|
Mouse    61 MTAAHC-SGRRMTVTLGA--HNVRKRECTQQKIKVEKYILPPNYNVSSKFNDIVLLKLKKQANLT 122

  Fly   118 NQVQ--PIPLAKTNPPPGSIAFVSGWGSSSY-YSHPIDLQGVNLYIQWPYYCGL----TEPSRIC 175
            :.|.  |:|.......||::.:.:|||.:.. .|....|:.|.|.|.....|.:    .:..:||
Mouse   123 SAVDVVPLPAPSDFAKPGTMCWAAGWGRTGLKKSISRTLREVELRIMGKKACKIFKHYKDSLQIC 187

  Fly   176 AGSFGRAAC--KGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWILNAID 230
            .||..:.|.  .|||||||:......|:||.|..:....:|:|.:.....||...|:
Mouse   188 VGSSTKVASVYMGDSGGPLLCAGVAHGIVSSGRGNAKPPAIFTRISPHVPWINRVIE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 58/221 (26%)
Tryp_SPc 27..225 CDD:238113 58/220 (26%)
Cma2NP_001019885.1 Tryp_SPc 20..239 CDD:214473 58/221 (26%)
Tryp_SPc 21..242 CDD:238113 60/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.