DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Mcpt4

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_062194.1 Gene:Mcpt4 / 54270 RGDID:3064 Length:246 Species:Rattus norvegicus


Alignment Length:271 Identity:70/271 - (25%)
Similarity:103/271 - (38%) Gaps:80/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQ------VSIQRDGKHL--CGGSIYSADII 62
            ||:.|.|.| .||     .|.|||    |:|..|..      :.|..:..|:  |||.:.|...:
  Rat     6 FLMALLLPS-GAG-----AEEIIG----GVESIPHSRPYMALLKIVTEEGHVTFCGGFLISLQFV 60

  Fly    63 ITAAHCVQGQGYQVRAG----SALKNSNGSVVDVAAI--RTHEGLGN--DIAIVRLSKPLEFTNQ 119
            :||||| .|:...|..|    |..:::...:..|..|  ..:....|  ||.:::|.:....|..
  Rat    61 LTAAHC-HGREITVTLGAHDMSKRESTQQKIKVVKQIFPLKYNLFSNFRDIMLLKLEQKAVLTPS 124

  Fly   120 VQPIPLAKTNP--PPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPS---------- 172
            |..|||.:::.  .||::...:|||.:                      |:.||:          
  Rat   125 VNVIPLPQSSDIIKPGTMCLAAGWGQT----------------------GVKEPNSNTLREVMLR 167

  Fly   173 -----------------RICAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSV 218
                             :||.|  ...:.|.|||||||||......|:||.|........|:|.:
  Rat   168 IMEMKACKDYRHYDNRFQICVGIPQMLKLAYKGDSGGPLVCAGVAHGIVSHGPGRGIPPIIFTRI 232

  Fly   219 PYFREWILNAI 229
            ..:..||...|
  Rat   233 SSYVSWINRVI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 59/245 (24%)
Tryp_SPc 27..225 CDD:238113 59/244 (24%)
Mcpt4NP_062194.1 Tryp_SPc 20..239 CDD:214473 59/245 (24%)
Tryp_SPc 21..242 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.