DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss36

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:109/247 - (44%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQGQG-------YQVRAGS 80
            |..||:||........|||||:...|.|:||||:.:...:::||||....|       :.|..| 
  Rat    55 PSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLG- 118

  Fly    81 ALKNSNGSVV-----DVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQVQPIPLAKTNP--PPG 133
             :.:.:|.:.     .||.|...:.     ||.|:|::||:.|.:....|:|:.|.:.:.  ..|
  Rat   119 -VHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAHG 182

  Fly   134 SIAFVSGWG---SSSYYSHPIDLQGVNLYIQWPYYC----------GLT---EPSRICAG--SFG 180
            :..:.:|||   .|.....|..||.|.|.:.....|          .||   .|..:|||  ...
  Rat   183 TACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGR 247

  Fly   181 RAACKGDSGGPLVFDQQ----LVGVVSGGTKDC---TYSSIYTSVPYFREWI 225
            |..|:||||||||.:..    |.|:.|.|. .|   ....::|:|.::..||
  Rat   248 RDTCQGDSGGPLVCEDGGRWFLAGITSFGF-GCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/242 (29%)
Tryp_SPc 27..225 CDD:238113 69/241 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 71/243 (29%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.