DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG34130

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:243 Identity:60/243 - (24%)
Similarity:95/243 - (39%) Gaps:45/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RPEERIIGGQPI----GIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQGQGYQVRAGSAL 82
            ||..|.:....|    |....||.:.|......:||.|..||...:|:|:|:.....|:.:.|..
  Fly    35 RPPVRTLNKNGIRRTSGGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVE 99

  Fly    83 KNSNGSVVDVAAIRTHE------------------GLGNDIAIVRLSKPLEFTNQVQPIPLAKTN 129
            ..|:.|..| ..:.:|:                  |...|:|::.|:..|. .|:...:.|. ||
  Fly   100 LVSSDSRQD-NQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLC-TN 161

  Fly   130 PPPGSIAFVSGWGSSSYYSHPI---------DLQGVNLYI-QWPYYCGLTEPSRICAGSFGRAA- 183
            |       :|.:.|.|..|:..         :::.:|..| ...|...|...:..||..|.|:| 
  Fly   162 P-------LSSYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSAD 219

  Fly   184 CKGDSGGPLVFDQQLVGVV--SGGTKDCTYSSIYTSVPYFREWILNAI 229
            |...:|.|:....||.|:|  |...|......|:|.:...:.:||.||
  Fly   220 CMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILKAI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 54/233 (23%)
Tryp_SPc 27..225 CDD:238113 53/232 (23%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 51/219 (23%)
Tryp_SPc 53..256 CDD:304450 51/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.