DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and intr

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:252 Identity:53/252 - (21%)
Similarity:85/252 - (33%) Gaps:89/252 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NSLSAGPVIRPEERIIGGQPIGIEEAPWQVS-----IQRDGKHLCGGSIYSADIIITAAHCV--- 69
            |||...|. ..|..:..||  ...|||..|.     |..:.|.:|.|::.|..:::|:|.|.   
  Fly    72 NSLEIIPA-EIETLLTDGQ--ATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRT 133

  Fly    70 ----QGQGYQVRAGSALKNSNGSVVDVAAIRTHEGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNP 130
                ..:.|:::|      |...:..||.:.|  |...|:|::.|..|||             :|
  Fly   134 LRQPPPRSYKLQA------SRSRIYSVANLIT--GAIEDMALLLLHAPLE-------------DP 177

  Fly   131 PPGSIAFVSGWGSSSYYSHPIDL--------QGVNLYIQWPYYCGLTE---PSRICAGSFGR--- 181
                            :.|||||        ..|.:|:...:...|..   |:..|..|:.:   
  Fly   178 ----------------FVHPIDLCESPLRRNDNVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDEN 226

  Fly   182 ----------------AACKGDSGGPLVFDQQLVGV-------VSGGTKDCTYSSIY 215
                            ..|:...|..|:...:|.||       ..||.....|:.::
  Fly   227 AFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 48/239 (20%)
Tryp_SPc 27..225 CDD:238113 48/238 (20%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.