DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG34129

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:95/260 - (36%) Gaps:73/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGG--QPIGIEEAPWQVSI-QRDGKHLCGGSIYSADIIITAAHCV-------QGQGYQVRAGS 80
            |:.||  ...|.....|.:.| ..||...||.:.|:..::||:|:|:       :|...:..|.|
  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS 103

  Fly    81 ALKNSNGSVVDVAAIR---THEGLGNDIAIVRLSKPL-----EFTNQVQPIPLAKTNPPPGSIAF 137
            .....|.:.:|.....   .::.|..|:|:|||..|:     ||      |.|......|.....
  Fly   104 ECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEF------IRLCSVKVQPKMQMV 162

  Fly   138 VSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPSRI---------CAGSF-------------- 179
            |.|||..            |..::.|    .::|..:         |...|              
  Fly   163 VFGWGFD------------NTEVEIP----SSDPRNVTVTIISIKECRQKFKSPKIASTSICARQ 211

  Fly   180 --GRAACKGDSGGPLVFDQQLVGVVSGGTK--DCTYSSIYTSVPYFREWI------LNAIDEIMS 234
              ....|..|.|.||::.::|.||||.|:.  |.:...:||::...:.:|      :||.|...|
  Fly   212 PKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDVFRS 276

  Fly   235  234
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 55/243 (23%)
Tryp_SPc 27..225 CDD:238113 54/242 (22%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 55/243 (23%)
Tryp_SPc 55..261 CDD:304450 51/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.