DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG17477

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:265 Identity:87/265 - (32%)
Similarity:124/265 - (46%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQR-DGKHLCGGSIYSADIIIT 64
            |.:..||..:.:.|.....::..|..|:|||.....:||:|||:|. .|.|||||:|.|...|||
  Fly     1 MSLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIIT 65

  Fly    65 AAHCVQG---QGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQVQ 121
            |.|||:|   ...||..|:......|:|....||..|     ....|||.::.|::.:.|....|
  Fly    66 AGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQ 130

  Fly   122 PIPLAKTNPPPGSIAFV-SGWGS-SSYYSHPIDLQGV-NLYIQWPYYCGLTE--------PSRIC 175
            .:.|..:..|.|:...| :|||| |:..|.|..||.| ..::..|....:..        |..||
  Fly   131 AVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHIC 195

  Fly   176 A---GSFGRAACKGDSGGPLVFDQQLVGVV------SGGTKDCTYSSIYTSVPYFREWILNAIDE 231
            |   .:.|  ||.||||||||....|||::      :.|..|     |:.::.|:|:|    :.:
  Fly   196 AYRQANIG--ACHGDSGGPLVHQGTLVGILNFFVPCAQGVPD-----IFMNIMYYRDW----MRQ 249

  Fly   232 IMSAN 236
            .||.|
  Fly   250 TMSGN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 78/227 (34%)
Tryp_SPc 27..225 CDD:238113 78/226 (35%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 79/233 (34%)
Tryp_SPc 27..246 CDD:214473 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.