DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG3916

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:290 Identity:83/290 - (28%)
Similarity:123/290 - (42%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQSFLLLLALNSLSAGPVIRPEE---RIIGGQPIGIEEAPWQVSI--QRDGK--HLCGGSIYSAD 60
            :|.|.:||.|....|..|....|   ||.|||.:. |..|:|||:  ||.|:  |.|||||.|..
  Fly     4 LQLFCMLLILRQGLADVVTSTTESPTRINGGQRVN-ETVPFQVSLQMQRRGRWQHFCGGSIVSGQ 67

  Fly    61 IIITAAHCVQGQGYQVRAGSALKNSNGSVVDVAAIRTHEG--------------------LGNDI 105
            .::|||||::          .:|..:.||| |..:....|                    :.|||
  Fly    68 HVLTAAHCME----------KMKVEDVSVV-VGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDI 121

  Fly   106 AIVRLSKPLEF------------TNQV-QPIPLAKTNPPPGSIAFVSGWGSSSYYSH----PIDL 153
            |:|:::.|...            :::: :.:|:..|           ||||:|..:.    |..|
  Fly   122 ALVKVTPPFRLERSDISTILIGGSDRIGEKVPVRLT-----------GWGSTSPSTSSATLPDQL 175

  Fly   154 QGVNLYIQWPYYCGLTEP-----------SRICAGSF-GRAACKGDSGGPLV---FDQQLVGVVS 203
            |.:|       |..::..           :.|||.:. |:.||.|||||||:   ....|||:||
  Fly   176 QALN-------YRTISNEDCNQKGFRVTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVS 233

  Fly   204 GGTKDCTYS--SIYTSVPYFREWILNAIDE 231
            .|:..|...  .:||.|..|..:|...|::
  Fly   234 YGSSTCAQGRPDVYTRVSSFLPYISQVINQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 73/256 (29%)
Tryp_SPc 27..225 CDD:238113 72/255 (28%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 73/256 (29%)
Tryp_SPc 31..260 CDD:238113 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.