DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Tryx5

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:249 Identity:59/249 - (23%)
Similarity:98/249 - (39%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQ-----RDGKHLCGGSIYSADIIITAAH 67
            ::.||.||:   |....|.::.|.....|..|...::.     :.....|.|::.....::||||
  Rat     5 IIFALLSLA---VASYPEVVLKGDQDSDEYLPENFNVPYMAYLKSSPEPCVGTLIDPLWVLTAAH 66

  Fly    68 CVQGQGYQVRAG---SALKNSNGSVVDVAAIRTHEGLG-----NDIAIVRLSKPLEFTNQVQPIP 124
            |  ....::|.|   ..:||....:...:....|....     ||:.:::||.|......|..|.
  Rat    67 C--SLPTKIRLGVYRPNIKNEKEQIHGYSLTVVHPNFDANIRKNDLMLIKLSYPATIDMYVGTIA 129

  Fly   125 LAKTNPPPGSIAFVSGWGSSSY--YSHPIDLQGVNLYIQWPYYCGLT-----EPSRI---CAG-S 178
            :|..........|:..|..:.|  ||.|..|...|.|.:.|..|..|     :.:||   |.| |
  Rat   130 IAMEPMVFNETCFIPTWTWNHYNNYSDPDTLTWTNQYSRSPSDCWNTLHQQRQETRINIMCIGHS 194

  Fly   179 FG-RAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS--IYTSVPYFREWILNAI 229
            |. :::.|..|..|.:...::.|::|.|....|..|  .:|.:..:..|||..:
  Rat   195 FNVKSSTKEVSAAPAICSGRVHGILSWGKAGITNGSEGFFTEIHPYARWILRVM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 50/225 (22%)
Tryp_SPc 27..225 CDD:238113 50/224 (22%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 47/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.