DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and Prss58

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001009174.1 Gene:Prss58 / 408204 RGDID:1303054 Length:240 Species:Rattus norvegicus


Alignment Length:256 Identity:55/256 - (21%)
Similarity:98/256 - (38%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHL-CGGSIYSADIIITAAHC--- 68
            |:..:.|...|......:.|.|..|      |:.|.::.|  :| |.|.:.....::|:|||   
  Rat     3 LVFCILSTLLGTFAYNPDHIAGTTP------PYLVYLKSD--YLPCTGVLIHPLWVVTSAHCNLP 59

  Fly    69 ----VQGQGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQVQPIP 124
                :.|    :...:.....:..|.|...:..|     ..:..|:.:::|.:.::.:...:.:.
  Rat    60 DLRVILG----ITNPADTTEHDVEVSDYEKMFRHPYFSVSSISYDLMLIKLRRGIKHSYYAKAVK 120

  Fly   125 LAKTNPPPGSIAFVSGWGSS--SYYSHPIDLQGVNLYIQWPYYC-------GLTEPSRICAGSF- 179
            |.:...|..::..||.|..:  .....|..||.||:.:.....|       .:.| :.||.|.. 
  Rat   121 LPQHTVPVNAMCSVSTWAYNLCDVTKEPDSLQTVNVSVISKAECHNAYKAFDIRE-NMICVGIVP 184

  Fly   180 -GRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSS---IYTSVPYFREWILNAIDEIMSAN 236
             .|..||..:..|.|.:..|.|::| ....|...:   ||.|:.::..||.|    ||..|
  Rat   185 GRRLPCKEVTAAPAVCNGVLYGILS-YADGCVLRADVGIYASIFHYMPWIEN----IMKNN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 46/225 (20%)
Tryp_SPc 27..225 CDD:238113 46/224 (21%)
Prss58NP_001009174.1 Tryp_SPc 28..233 CDD:214473 43/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.