DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG11037

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:119/259 - (45%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALNSLSAGPVIRP---EERIIGGQ-PIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQ 70
            |.|:......::.|   |.|:|||. ....:...:..::..:...:|||::.:.:|::|||||..
  Fly    42 LTLDVAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFL 106

  Fly    71 GQ----GYQVRAGSALKNSNGSVVDVAAIRTH------------EGLGNDIAIVRLSKPLEFTNQ 119
            |:    .:.|.||.:..|..|       ||.|            :.:..|:|:|.|..||:..| 
  Fly   107 GRMKASEWIVAAGISNLNQKG-------IRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKN- 163

  Fly   120 VQPIPLAKTNPPPGSIAFVSGWGSSSYYS---HPIDLQGVNLYIQWPYYC-GLTEP------SRI 174
            :..:.|...:..||....|||||.::...   |.: |:.|.:.|.....| ...:|      |.|
  Fly   164 IGTLSLCSVSLKPGVELVVSGWGMTAPRGRGPHNL-LRTVTVPIIHKKNCRAAYQPTAKITDSMI 227

  Fly   175 CAGSFGRA-ACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREWILNAIDEIMS 234
            ||...||. ||..||||||||.:|:.|:||.|. .|.   |..:||.|.|.:.:|..:|..:::
  Fly   228 CAAVLGRKDACTFDSGGPLVFKKQVCGIVSFGI-GCASNRYPGVYTDVMYVKPFIEKSIKALLA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 70/229 (31%)
Tryp_SPc 27..225 CDD:238113 69/228 (30%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 70/229 (31%)
Tryp_SPc 62..283 CDD:238113 70/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.