DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG4477

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:220 Identity:55/220 - (25%)
Similarity:89/220 - (40%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HLCGGSIYSADIIITAAHCVQGQGYQVRAGSALKNSNGSVVDVAAIR--------THEGLGN--- 103
            |.|.|.|.:...::|:|||:..:...:.:...|....|::..:..|.        ||..|.:   
  Fly    70 HFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSFT 134

  Fly   104 -----DIAIVRLSKPLEFTNQVQPIPLAKTNPP-PGSIAFVSGWGS-------SSYYSHPIDLQG 155
                 |..::::..|....|:...|.....:|| ||....|.|||.       :||..: ||:|.
  Fly   135 MRNKQDFGLLKVKNPFPRNNEHISIARLPVHPPLPGLKCKVMGWGRMYKGGPLASYMLY-IDVQV 198

  Fly   156 VN--LYIQWPYYCGLTEPS--RICA----GSFGRAACKGDSGGPLVFDQQLVGVVS--GGTKDCT 210
            ::  ...:|     |..||  .:||    ....:..|.||.|.|::.:..:.|:|:  .|.....
  Fly   199 IDSEACAKW-----LRVPSVEHVCAVDSDDLTAQQPCGGDWGAPMLHNGTVYGIVTILAGCGVSH 258

  Fly   211 YSSIYTSVPYFREWILNAIDEIMSA 235
            ..|:||:|.....||...|  |.||
  Fly   259 LPSLYTNVHSNANWIHEKI--ISSA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 49/208 (24%)
Tryp_SPc 27..225 CDD:238113 49/208 (24%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 51/211 (24%)
Tryp_SPc 55..273 CDD:214473 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.