DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG32374

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:106/256 - (41%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSFLLLLALNSLSAGPVIRPEE-------RIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADI 61
            |:||    ..::|..|.|...|       ||:.|:.|....||:|.::..:...:||..|.:...
  Fly    48 QTFL----PGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRW 108

  Fly    62 IITAAHCVQGQ--GYQVRAGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQ 119
            |:||.||..|.  .|.|||||..:...|.:..|.....|..     :.||:.:::|..||.....
  Fly   109 ILTAQHCKIGNPGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRC 173

  Fly   120 VQPIPLAKTNP---PPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTE----------- 170
            ||.:.|..|..   |...:|  ||||.:|     .:.|.|..|::....|.::.           
  Fly   174 VQKVKLPSTRTKRFPKCYLA--SGWGLTS-----ANAQNVQRYLRGVIVCKVSRAKCQQDYRGTG 231

  Fly   171 ----PSRICAGSFGRAACKGDSGGPLVFDQQLVGVVSG--GTKDCTYSSIYTSVPYFREWI 225
                ...|||....|..|.||||||||.:..|.|:.|.  |.....|..:|.:|..:..||
  Fly   232 IKIYKQMICAKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 65/225 (29%)
Tryp_SPc 27..225 CDD:238113 64/224 (29%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 65/225 (29%)
Tryp_SPc 74..295 CDD:238113 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.