DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG6592

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:262 Identity:82/262 - (31%)
Similarity:115/262 - (43%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALNSLSAGPVIR---PE-----ERIIGGQPIGIEEAPWQVS--IQR-DGKHLCGGSIYSADIII 63
            |.|| |...|::.   ||     :||.||........|:||.  :|| .|.:.||||:.|...:|
  Fly    99 LVLN-LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVI 162

  Fly    64 TAAHCVQ--GQGYQVRAGSALKNS--NGSV--------VDVAAIRTHEGLGNDIAIVRLSKPLEF 116
            ||||||.  .:.......:.:||:  .|.|        ..:......:.|.:|||||||...:.|
  Fly   163 TAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSF 227

  Fly   117 TNQVQPIPLAKTNPP----PGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLT-------- 169
            ..::.||.|.|.:..    ...:|..||||..:...|.|  ..|..|:|.....|.|        
  Fly   228 NERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAI--SNVLRYVQLQIIDGRTCKSNFPLS 290

  Fly   170 -EPSRIC-AGSFGRAACKGDSGGPLVFDQQ------LVGVVSGGT---KDCTYSSIYTSVPYFRE 223
             ..:.|| :|...|:.|.||||||||..::      |||:.|.|:   .|..|.:.:|.|..:.:
  Fly   291 YRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLD 355

  Fly   224 WI 225
            ||
  Fly   356 WI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 73/236 (31%)
Tryp_SPc 27..225 CDD:238113 72/235 (31%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/236 (31%)
Tryp_SPc 123..359 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.