DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and KLK1

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:263 Identity:78/263 - (29%)
Similarity:112/263 - (42%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65
            |:.....|.|:|....|.|.|  :.||:||........|||.::.......|||.:.....::||
Human     1 MWFLVLCLALSLGGTGAAPPI--QSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTA 63

  Fly    66 AHCVQGQGYQVRAG--SALKNSN-GSVVDVAAIRTHEGL----------------GNDIAIVRLS 111
            |||: ...||:..|  :...:.| ...|.|:....|.|.                .:|:.::||:
Human    64 AHCI-SDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLT 127

  Fly   112 KPLE-FTNQVQPIPLAKTNPPPGSIAFVSGWGS--SSYYSHPIDLQGVNLYIQWPYYCGLTEPSR 173
            :|.: .|:.|:.:.|....|..||....|||||  ...:|.|.|||.|:|.|.....|......:
Human   128 EPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQK 192

  Fly   174 I-----CAGSF--GRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWILNA 228
            :     |.|..  |:..|.|||||||:.|..|.||.|.|...|   ...|:...|..:.:||.:.
Human   193 VTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDT 257

  Fly   229 IDE 231
            |.|
Human   258 IAE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 67/230 (29%)
Tryp_SPc 27..225 CDD:238113 66/229 (29%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.