DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Send2 and CG32269

DIOPT Version :9

Sequence 1:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:234 Identity:74/234 - (31%)
Similarity:118/234 - (50%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG---QGYQVRAG-SALKN 84
            :.||:||....|...|:.|.::| |.:||.||:.:...::||||||:|   ..:.||.| :.|..
  Fly   106 QSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDG 169

  Fly    85 SNG-----SVVDVAAIRTHEGLGNDIAIVRLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWG-- 142
            |:|     |.:.||...|.:.:..|.|:::|::.|..|| :..|.:....|..||...::|||  
  Fly   170 SDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN-IGTISMGNYRPKAGSRVRIAGWGVT 233

  Fly   143 --SSSYYSHPIDLQGVNLYIQWPY---YCGLTEPSR--ICAGSFGRAACKGDSGGPLVFDQQLVG 200
              .|:..|..:....:.:..|...   |.|....::  :||.:.|:.:|.||||||:..:..|:|
  Fly   234 KEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCSGDSGGPVTRNNTLLG 298

  Fly   201 VVSGGTKDCT---YSSIYTSVPYFREWILNAIDEIMSAN 236
            :||.| ..|.   |..:||:|...|:|..|    ||:.|
  Fly   299 IVSFG-YGCARAGYPGVYTAVVAIRQWATN----IMANN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 69/219 (32%)
Tryp_SPc 27..225 CDD:238113 68/218 (31%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 69/218 (32%)
Tryp_SPc 121..324 CDD:238113 64/205 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.